If you have been reading about Whey protein and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-09-08. Numbers and descriptions here follow the published literature rather than marketing material.
Quality control checks identity, composition, and contaminants. Moisture, ash, fat, and carbohydrate are measured by standard methods, and microbiological limits are set for total counts, coliforms, and specific pathogens. Heavy metals and pesticide residues may be monitored depending on market requirements. Adulteration with intact whey protein or individual amino acids is possible, so peptide fingerprints and free amino acid profiles can help verify authenticity. Regulatory frameworks vary: some countries treat hydrolyzed whey as a conventional dairy ingredient, while infant formula uses face additional compositional rules. Which marker peptides best confirm source and processing remains an open analytical question.
Storage stability depends on moisture, temperature, and packaging. Dry powders with low water activity resist microbial growth, but they can still absorb water, develop off-colors through Maillard reactions, or oxidize residual lipids. Sealed containers kept in a cool, dry place are standard. Stability studies typically monitor moisture, solubility, color, peptide size, and microbial counts over months. Established practice favors low humidity and moderate temperatures. How brief excursions above recommended conditions affect peptide profiles and sensory qualities is less predictable and may depend on the specific product matrix.
Laboratories characterize hydrolyzed whey protein with several complementary assays. Total nitrogen methods, such as Kjeldahl or Dumas, estimate protein content using a dairy conversion factor. Free amino group assays, including TNBS and OPA, track the extent of peptide-bond cleavage. Size-exclusion chromatography and reversed-phase HPLC reveal peptide size distributions and hydrophobicity. Mass spectrometry can identify specific peptides, while amino acid analysis quantifies individual residues. No single test captures every relevant property, so results are usually interpreted together with process records and specification limits.
Whey protein hydrolysate appears in foods and supplements where rapid digestion, low viscosity, or reduced intact-protein content is desired. It is distinct from whey protein isolate and concentrate, which contain largely intact proteins, though hydrolysates can be made from either. In infant formula, extensively hydrolyzed whey is used in some specialty products, while partially hydrolyzed forms appear in other formulations. Human health effects depend on the specific peptide mixture and are not uniform across all hydrolysates.
Whey protein hydrolysate is a dairy ingredient produced when whey proteins are treated with proteolytic enzymes or, less commonly, acid or heat under controlled conditions. The treatment cleaves peptide bonds and yields shorter peptide chains than those found in intact whey protein. The starting material is usually sweet whey or acid whey from cheese manufacture, concentrated by membrane filtration before hydrolysis. The resulting ingredient retains many amino acids from the original protein but differs in molecular size, solubility, and taste profile.
| Property | Value | Notes |
|---|---|---|
| Total protein | 70–85% dry basis | Kjeldahl or Dumas with factor 6.38. |
| Peptide-bond cleavage | 5–35% | TNBS or OPA; assay-dependent. |
| Peptide size | Mostly 0.2–10 kDa | Size-exclusion chromatography. |
| Water activity | Below 0.6 | Limits microbial growth in powder. |
| Shelf life | 18–24 months | Sealed, cool, dry storage; product-specific. |
Stability and storage practices affect measured quality over time. Hydrolysate powders are hygroscopic and can absorb moisture, leading to caking, Maillard browning, and reduced solubility. Cool, dry storage in sealed containers limits these changes, while high humidity and warm temperatures accelerate them. Microbiological testing for total aerobic counts, yeasts, molds, and specified pathogens is typical for food ingredients. Regulatory status varies by country; in many jurisdictions hydrolyzed whey protein is regulated as a food ingredient rather than a drug, and claims about reduced allergenicity require specific substantiation.
Quality control for whey protein hydrolysate begins with verifying protein content, moisture, ash, and fat using standard food analysis methods. Total nitrogen by Kjeldahl or Dumas combustion gives an estimate of protein, often calculated with a dairy-specific conversion factor. Amino acid analysis after acid hydrolysis quantifies individual residues but destroys tryptophan and may convert glutamine and asparagine. The extent of peptide bond cleavage is usually estimated by measuring free amino groups, soluble nitrogen, or trichloroacetic acid-soluble peptides. These tests are operationally defined and can give different results across laboratories.
Compared with whey protein concentrate or isolate, hydrolysate has a smaller average peptide size and a higher proportion of low-molecular-weight fractions. This change can affect solubility, viscosity, osmolality, taste, and foam formation. Some hydrolysates are bitter because hydrophobic peptides are exposed during cleavage. The term hydrolysate does not indicate a guaranteed peptide profile; two products with the same reported hydrolysis value can differ in peptide sequence and residual intact protein. Commercial specifications usually state protein content, moisture, ash, fat, and microbiology, while peptide distribution may be reported as a range.
Whey protein hydrolysate appears in infant formula, sports nutrition, and clinical nutrition. In infant formula, extensively hydrolyzed products are used when a reduced allergenicity is desired, though not all hydrolysates are hypoallergenic. In sports products, the ingredient is marketed for rapid amino acid delivery, but the practical advantage over intact whey protein remains debated. Research often compares hydrolysate with isolate or concentrate for absorption kinetics, muscle protein synthesis, and gastrointestinal tolerance. Regulatory categories differ by country, and label terms such as partially hydrolyzed or extensively hydrolyzed are defined in some jurisdictions but not others.
Whey protein hydrolysate is a dairy ingredient made by treating whey protein with proteolytic enzymes. The starting material is whey, the liquid remaining after cheese or casein production, and its main proteins include beta-lactoglobulin, alpha-lactalbumin, and bovine serum albumin. Enzyme action breaks peptide bonds, producing shorter peptides and some free amino acids. The result is not a single uniform substance; composition depends on whey source, enzyme type, hydrolysis conditions, and downstream filtration. Hydrolysates are often described by average peptide length or degree of hydrolysis rather than by one fixed molecular weight.
Hydrolysate powders are hygroscopic and can absorb moisture during storage, which may promote caking, browning, and loss of solubility. Cool, dry conditions and sealed packaging slow these changes, while high humidity and warm temperatures accelerate Maillard reactions between peptides and residual sugars. Liquid hydrolysates are more perishable and often require refrigeration or preservatives. Shelf-life studies usually monitor moisture, color, solubility, free amino groups, and microbial load over time. Stability depends on residual lactose, water activity, packaging barrier properties, and the initial peptide profile.
Degree of hydrolysis is commonly estimated by titrating liberated carboxyl groups, measuring soluble nitrogen in trichloroacetic acid, or using o-phthaldialdehyde assays. Molecular weight distribution is often examined by size-exclusion chromatography, sodium dodecyl sulfate polyacrylamide gel electrophoresis, or mass spectrometry. These methods answer different questions: titration estimates bond cleavage, while chromatography describes peptide size ranges. Because no single reference method is universally applied, values reported by different laboratories may not be directly comparable. Method details such as calibration standards and sample preparation strongly influence results.
Enzyme choice influences the peptide size distribution and the resulting functional properties. Some proteases cut at specific amino acid residues, while others act more broadly, so two hydrolysates with the same degree of hydrolysis can differ in peptide sequences. Short peptides are generally more water-soluble and less likely to form gels under heat, although bitterness can increase when hydrophobic residues become exposed. The relationship between peptide length, taste, and bioactivity is an active area of study, and not all proposed effects are established in human trials.
Composition tables often report protein content on a dry basis, ash, moisture, fat, and lactose. Because hydrolysis adds water to peptide bonds, the total mass yield can appear slightly higher than the original protein if residual salts and water are counted. Some products are further processed by ultrafiltration, spray drying, or decolorization, which alters mineral content and flavor. Product labels may distinguish partially hydrolyzed from extensively hydrolyzed whey, but these terms are not always defined by a single numerical threshold across regions.
Understanding of the molecular basis of binding to integrins has enabled the development of several drugs for cardiovascular disease and cancer, including eptifibatide, tirofiban and cilengitide. These drugs inhibit integrin binding. PET radiotracers such as fluciclatide utilize RGD-containing peptides to home to tumors, allowing for cancer monitoring. Eptifibatide and tirofiban are anti-clotting drugs indicated to prevent thrombosis in acute ischemic coronary syndromes. Eptifibatide is additionally FDA approved for patients undergoing percutaneous coronary intervention. These drugs block activation of the integrin responsible for aggregation of platelets (αIIbβ3, also known as glycoprotein IIb/IIIa) in response to the blood glycoproteins fibrinogen and von Willebrand factor. Eptifibatide (marketed as Integrilin) is a cyclic (circular) seven amino acid peptide, whereas tirofiban is a small molecule designed to mimic the chemistry and binding affinity of the RGD sequence.
1,3-Beta-glucan synthase is a glucosyltransferase enzyme involved in the generation of beta-glucan in fungi. It serves as a pharmacological target for antifungal drugs such as caspofungin, anidulafungin, and micafungin, deemed 1,3-Beta-glucan synthase inhibitors. Under the CAZy classification system, fungi and plant members fall in the glycosyltransferase 48 family (GT48). Some members of the glycosyltransferase 2 family (Pfam PF13632), such as the curdlan synthase CrdS (Q9X2V0), also has a similar activity. The biosynthesis of disaccharides, oligosaccharides, and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The family consists of various 1,3-beta-glucan synthase components including Gls1, Gls2, and Gls3 from yeast. 1,3-Beta-glucan synthase (EC 2.4.1.34.) also known as callose synthase catalyses the formation of a beta-1,3-glucan polymer that is a major component of the fungal cell wall. The reaction catalysed is:
This family is the DUF1884 domain-containing protein family of encapsulins. They have a truncated form of the HK97-fold and are considered putative, with their ability to self-assemble and encapsulate cargo proteins still unknown. This family is limited to thermophilic and anaerobic microorganisms from hydrothermal vents. They are hypothesized to form specialized nanocompartments adapted to extreme environmental conditions. Encapsulins have become widely used and are gaining more attention in biomolecular and protein engineering applications due to their strong self-assembly properties and ease of engineering. They are used and have significant potential for: Drug Delivery: Engineered for targeted delivery of therapeutic agents. Imaging: Functionalized for use as MRI contrast agents. Vaccines: Surface display of antigens for vaccine development, e.g., SARS-CoV-2 antigen studies. Bioreactors: Utilized as nanocontainers for enzymatic reactions. Biosensors: Leverage their metal-binding encapsulation specificity for diagnostic tools.
Programmed cell death in plants has a number of molecular similarities to that of animal apoptosis, but it also has differences, notable ones being the presence of a cell wall and the lack of an immune system that removes the pieces of the dead cell. Instead of an immune response, the dying cell synthesizes substances to break itself down and places them in a vacuole that ruptures as the cell dies. Additionally, plants do not contain phagocytic cells, which are essential in the process of breaking down and removing apoptotic bodies. Whether this whole process resembles animal apoptosis closely enough to warrant using the name apoptosis (as opposed to the more general programmed cell death) is unclear.
The BtuCD and HI1470/1 are classified as large (Type II) ABC importers. The transmembrane subunit of the vitamin B12 importer, BtuCD, contains 10 TM helices and the functional unit consists of two copies each of the nucleotide binding domain (NBD) and transmembrane domain (TMD). The TMD and NBD interact with one another via the cytoplasmic loop between two TM helices and the Q loop in the ABC. In the absence of nucleotide, the two ABC domains are folded and the dimer interface is open. A comparison of the structures with (BtuCDF) and without (BtuCD) binding protein reveals that BtuCD has an opening that faces the periplasm whereas in BtuCDF, the outward-facing conformation is closed to both sides of the membrane. The structures of BtuCD and the BtuCD homolog, HI1470/1, represent two different conformational states of an ABC transporter. The predicted translocation pathway in BtuCD is open to the periplasm and closed at the cytoplasmic side of the membrane while that of HI1470/1 faces the opposite direction and open only to the cytoplasm. The difference in the structures is a 9° twist of one TM subunit relative to the other.
Sources: en.wikipedia.org
2023 Analytical Scientist the Power List - Leaders and Advocates 2020 Society for Glycobiology Molecular and Cellular Proteomics (MCP) / American Society for Biochemistry and Molecular Biology (ASBMB) Lectureship Award 2019 inaugural winner of the US Human Proteome Organization Lifetime Achievement in Proteomics Award 2019 Analytical Scientist the Power List 2017 American Society for Mass Spectrometry John B. Fenn Award for a Distinguished Contribution in Mass Spectrometry 2016 American Association for the Advancement of Science Fellow 2015 Human Proteome Organization Distinguished Service Award 2015 German Mass Spectrometry Society (Deutsche Gesellschaft für Massenspektrometrie, DGMS) Wolfgang Paul Lecture 2013 Boston University The William Fairfield Warren Distinguished Professorship 2011 American Chemical Society Fellow 2010 American Chemical Society Frank H. Field and Joe L. Franklin Award for Outstanding Achievement in Mass Spectrometry 2009 International Mass Spectrometry Foundation Thomson Medal 2008 Human Proteome Organization Discovery in Proteomic Sciences Award
An investigational device exemption (IDE) allows an investigational device (i.e. a device that is the subject of a clinical study) to be used in order to collect safety and effectiveness data required to support a premarket approval (PMA) application or a premarket notification [510(k)] submission to Food and Drug Administration (FDA). Clinical studies are most often conducted to support a PMA. Only a small percentage of 510(k)'s require clinical data to support the application. Investigational use also includes clinical evaluation of certain modifications or new intended uses of legally marketed devices. All clinical evaluations of investigational devices, unless exempt, must have an approved IDE before the study is initiated. Clinical evaluation of devices that have not been cleared for marketing requires:
When the B cells get activated, class switching can occur. The class switching involves switch regions that made up of multiple copies of short repeats (GAGCT and TGGGG). These switches occur at the level of rearrangements of the DNA because there is a looping event that chops off the constant regions for IgM and IgD and form the IgG mRNAs. Any continuous looping occurrence will produce IgE or IgA mRNAs. In addition, cytokines are factors that have great effects on class switching of different classes of antibodies. Their interaction with B cells provides the appropriates signals needed for B cells differentiation and eventual class switching occurrence. For example, interleukin-4 induces the rearrangements of heavy chain immunoglobulin genes. That is IL- 4 induces the switching of Cμ to Cγ to Cκ
44. Adv Gerontol. 2004;13:90-3. [Effect of epitalon on the immunity and hemostasis in hypophysectomized chicken and old hens]. [Article in Russian] Kuznik BI, Pateiuk AV, Khavinson VKh, Malinin VV. Neonatal hypophysectomy in chicken, as well as that in old hen has been established to entail in 1,5 months after surgery cellular and humoral immunity disturbances, pronounced hypercoagulation and fibrinolysis depression. Administration of Epitalon (Ala-Glu-Asp-Gly) to a large extent eliminates revealed shifts. This effect appeared to be stronger in neonatally hypophysectomized chicken than in old hens.
Nevertheless, the resistance of extracellular matrix proteins to proteolysis renders their advanced glycation end products less conducive to being eliminated. While the AGE free adducts are released directly into the urine, AGE peptides are endocytosed by the epithelial cells of the proximal tubule and then degraded by the endolysosomal system to produce AGE amino acids. It is thought that these acids are then returned to the kidney's inside space, or lumen, for excretion. AGE free adducts are the major form through which AGEs are excreted in urine, with AGE-peptides occurring to a lesser extent but accumulating in the plasma of patients with chronic kidney failure. Larger, extracellularly derived AGE proteins cannot pass through the basement membrane of the renal corpuscle and must first be degraded into AGE peptides and AGE free adducts. Peripheral macrophage as well as liver sinusoidal endothelial cells and Kupffer cells have been implicated in this process, although the real-life involvement of the liver has been disputed.
Sources: en.wikipedia.org
The tournament will be hosted by whoever wins the regular season title. Right now, either James Madison or Old Dominion will host the tournament, depending on their regular season outcomes. Last updated: October 31, 2011Source: NMN Athletics Colonial Athletic Association 2011 CAA Men's Soccer Tournament 2011 NCAA Division I men's soccer season 2011 NCAA Division I Men's Soccer Championship
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
3-M syndrome or 3M3 is a rare hereditary disorder characterized by severe growth retardation, facial dysmorphia, and skeletal abnormalities. The name 3-M is derived from the initials of the three researchers who first identified it: Miller, McKusick, and Malvaux; they reported their findings in the medical literature in 1972. Mutations in any one of the following three genes: CUL7, OBSL1, and CCDC8 are responsible for the occurrence of this disorder. It is inherited through an autosomal recessive pattern and considered very rare, so far less than 100 cases worldwide have been identified. Diagnosis is based on the presence of clinical features. Genetic testing can confirm the diagnosis and identify the specific gene involved. Treatment is aimed at addressing the growth and skeletal problems and may include surgical bone lengthening, adaptive aids, and physical therapy. An endocrinologist may assist with growth hormone replacement and appropriate evaluations during puberty.
Folic acid, which is the synthetic form of the vitamin folate, is critical both in pre- and peri-conception. Deficiencies in folic acid may cause neural tube defects (NTDs). Women who had 0.4 mg of folic acid in their systems due to supplementing 3 months before childbirth significantly reduced the risk of NTDs. More than 80 countries use fortification of certain foods with folic acid as a measure to decrease the rate of NTDs.
Sources: en.wikipedia.org
Common laboratory methods measure free amino groups with TNBS or OPA reagents. The result is converted to a percentage using a reference standard and a defined protocol. Values are method-dependent, so comparisons require the same assay conditions.
Size-exclusion chromatography separates peptides by molecular size, while reversed-phase HPLC separates them by hydrophobicity. Mass spectrometry provides mass and sequence information for individual peptides. Together these methods give a more complete picture than any single technique.
Yes, free amino group assays and peptide profiles usually differ between the two. However, blends and partially hydrolyzed samples can make interpretation difficult. Authenticity testing often combines several methods rather than relying on one marker.
It is made from whey, a byproduct of cheese or casein production, or from whey protein concentrate or isolate. Enzymes break the intact whey proteins into shorter peptides. The final composition depends on the starting whey and the hydrolysis conditions.